| Brand: | Abnova |
| Reference: | H00093659-M02 |
| Product name: | CGB5 monoclonal antibody (M02), clone 2E7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CGB5. |
| Clone: | 2E7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 93659 |
| Gene name: | CGB5 |
| Gene alias: | HCG|MGC119822 |
| Gene description: | chorionic gonadotropin, beta polypeptide 5 |
| Genbank accession: | BC006290 |
| Immunogen: | CGB5 (AAH06290, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ |
| Protein accession: | AAH06290 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CGB5 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |