Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CGB5 monoclonal antibody (M01A), clone 3E4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about CGB5 monoclonal antibody (M01A), clone 3E4
| Brand: | Abnova |
| Reference: | H00093659-M01A |
| Product name: | CGB5 monoclonal antibody (M01A), clone 3E4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CGB5. |
| Clone: | 3E4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 93659 |
| Gene name: | CGB5 |
| Gene alias: | HCG|MGC119822 |
| Gene description: | chorionic gonadotropin, beta polypeptide 5 |
| Genbank accession: | NM_033043 |
| Immunogen: | CGB5 (NP_149032, 62 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQD |
| Protein accession: | NP_149032 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |