View larger

MGC16169 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of MGC16169 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00093627-A01
Product name:	MGC16169 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant MGC16169.
Gene id:	93627
Gene name:	MGC16169
Gene alias:	HSPC302
Gene description:	hypothetical protein MGC16169
Genbank accession:	NM_033115
Immunogen:	MGC16169 (NP_149106, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	QQLRDRLLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPSSDSSGGRSSAPYFSAECPDPPKTDLSRESIPLNDLKSEVSPRI
Protein accession:	NP_149106
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.11 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice