| Brand: | Abnova |
| Reference: | H00093624-M08 |
| Product name: | MGC21874 monoclonal antibody (M08), clone 1C8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MGC21874. |
| Clone: | 1C8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 93624 |
| Gene name: | TADA2B |
| Gene alias: | ADA2(beta)|ADA2B|MGC21874 |
| Gene description: | transcriptional adaptor 2 (ADA2 homolog, yeast)-beta |
| Genbank accession: | XM_291105 |
| Immunogen: | MGC21874 (XP_291105, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY |
| Protein accession: | XP_291105 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to MGC21874 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The double histone acetyltransferase complex ATAC is essential for mammalian development.Guelman S, Kozuka K, Mao Y, Pham V, Solloway MJ, Wang J, Wu J, Lill JR, Zha J. Mol Cell Biol. 2009 Mar;29(5):1176-88. Epub 2008 Dec 22. |