No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00093624-M06 |
Product name: | MGC21874 monoclonal antibody (M06), clone 3F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MGC21874. |
Clone: | 3F3 |
Isotype: | IgG2a Kappa |
Gene id: | 93624 |
Gene name: | TADA2B |
Gene alias: | ADA2(beta)|ADA2B|MGC21874 |
Gene description: | transcriptional adaptor 2 (ADA2 homolog, yeast)-beta |
Genbank accession: | XM_291105 |
Immunogen: | MGC21874 (XP_291105, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY |
Protein accession: | XP_291105 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | MGC21874 monoclonal antibody (M06), clone 3F3. Western Blot analysis of MGC21874 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |