> >>MGC21874 polyclonal antibody (A01)
MGC21874 polyclonal antibody (A01) View larger

MGC21874 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of MGC21874 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MGC21874 polyclonal antibody (A01)

Brand: Abnova
Reference: H00093624-A01
Product name: MGC21874 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant MGC21874.
Gene id: 93624
Gene name: TADA2B
Gene alias: ADA2(beta)|ADA2B|MGC21874
Gene description: transcriptional adaptor 2 (ADA2 homolog, yeast)-beta
Genbank accession: XM_291105
Immunogen: MGC21874 (XP_291105, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY
Protein accession: XP_291105
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00093624-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MGC21874 polyclonal antibody (A01) now

Add to cart