MYLC2PL MaxPab mouse polyclonal antibody (B01) View larger

MYLC2PL MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYLC2PL MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MYLC2PL MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00093408-B01
Product name: MYLC2PL MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human MYLC2PL protein.
Gene id: 93408
Gene name: MYLC2PL
Gene alias: PLRLC
Gene description: myosin light chain 2, precursor lymphocyte-specific
Genbank accession: NM_138403
Immunogen: MYLC2PL (NP_612412, 1 a.a. ~ 226 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
Protein accession: NP_612412
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00093408-B01-13-15-1.jpg
Application image note: Western Blot analysis of MYLC2PL expression in transfected 293T cell line (H00093408-T01) by MYLC2PL MaxPab polyclonal antibody.

Lane 1: MYLC2PL transfected lysate(24.86 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MYLC2PL MaxPab mouse polyclonal antibody (B01) now

Add to cart