Brand: | Abnova |
Reference: | H00093183-A01 |
Product name: | PIGM polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PIGM. |
Gene id: | 93183 |
Gene name: | PIGM |
Gene alias: | GPI-MT-I|MGC29896 |
Gene description: | phosphatidylinositol glycan anchor biosynthesis, class M |
Genbank accession: | NM_145167 |
Immunogen: | PIGM (NP_660150, 35 a.a. ~ 96 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | YGVFQDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYTPLLGWLLTPNIYLSELFGK |
Protein accession: | NP_660150 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.93 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PIGM polyclonal antibody (A01), Lot # 051214JC01 Western Blot analysis of PIGM expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |