Brand: | Abnova |
Reference: | H00093100-D01 |
Product name: | NAPRT1 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human NAPRT1 protein. |
Gene id: | 93100 |
Gene name: | NAPRT1 |
Gene alias: | PP3856 |
Gene description: | nicotinate phosphoribosyltransferase domain containing 1 |
Genbank accession: | NM_145201 |
Immunogen: | NAPRT1 (NP_660202.2, 1 a.a. ~ 466 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQGQVAAPPPSS |
Protein accession: | NP_660202.2 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of NAPRT1 transfected lysate using anti-NAPRT1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NAPRT1 purified MaxPab mouse polyclonal antibody (B01P) (H00093100-B01P). |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |