RP11-484I6.3 MaxPab mouse polyclonal antibody (B01) View larger

RP11-484I6.3 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RP11-484I6.3 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RP11-484I6.3 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00093081-B01
Product name: RP11-484I6.3 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human RP11-484I6.3 protein.
Gene id: 93081
Gene name: C13orf27
Gene alias: -
Gene description: chromosome 13 open reading frame 27
Genbank accession: NM_138779.2
Immunogen: RP11-484I6.3 (NP_620134.2, 1 a.a. ~ 186 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNLPHLMSLASHLASHGFFCLRFTCKGLNIVHRIKAYKSVLNYLKTSGEYKLAGVFLGGRSMGSRAAASVMCHIEPDDGDDFVRGLICISYPLHHPKQQHKLRDEDLFRLKEPVLFVSGSADEMCEKNLLEKVAQKMQAPHKIHWIEKANHSMAVKGRSTNDVFKEINTQILFWIQEITEMDKKCH
Protein accession: NP_620134.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00093081-B01-13-15-1.jpg
Application image note: Western Blot analysis of C13orf27 expression in transfected 293T cell line (H00093081-T01) by C13orf27 MaxPab polyclonal antibody.

Lane 1: RP11-484I6.3 transfected lysate(20.46 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RP11-484I6.3 MaxPab mouse polyclonal antibody (B01) now

Add to cart