| Brand: | Abnova |
| Reference: | H00092935-Q01 |
| Product name: | MARS2 (Human) Recombinant Protein (Q01) |
| Product description: | Human MARS2 partial ORF ( NP_612404, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 92935 |
| Gene name: | MARS2 |
| Gene alias: | MetRS|mtMetRS |
| Gene description: | methionyl-tRNA synthetase 2, mitochondrial |
| Genbank accession: | NM_138395 |
| Immunogen sequence/protein sequence: | MLRTSVLRLLGRTGASRLSLLEDFGPRYYSSGSLSAGDDACDVRAYFTTPIFYVNAAPHIGHLYSALLADALCRHRRLRGPSTAATRFSTGTDEHGLKIQQAAATA |
| Protein accession: | NP_612404 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Mutations in the Mitochondrial Methionyl-tRNA Synthetase Cause a Neurodegenerative Phenotype in Flies and a Recessive Ataxia (ARSAL) in Humans.Bayat V, Thiffault I, Jaiswal M, Tetreault M, Donti T, Sasarman F, Bernard G, Demers-Lamarche J, Dicaire MJ, Mathieu J, Vanasse M, Bouchard JP, Rioux MF, Lourenco CM, Li Z, Haueter C, Shoubridge EA, Graham BH, Brais B, Bellen HJ. PLoS Biol. 2012 Mar;10(3):e1001288. Epub 2012 Mar 20. |