UBE2Q2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

UBE2Q2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2Q2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about UBE2Q2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00092912-D01P
Product name: UBE2Q2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human UBE2Q2 protein.
Gene id: 92912
Gene name: UBE2Q2
Gene alias: DKFZp762C143
Gene description: ubiquitin-conjugating enzyme E2Q family member 2
Genbank accession: NM_173469.1
Immunogen: UBE2Q2 (NP_775740.1, 1 a.a. ~ 375 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG
Protein accession: NP_775740.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00092912-D01P-2-A7-1.jpg
Application image note: UBE2Q2 MaxPab rabbit polyclonal antibody. Western Blot analysis of UBE2Q2 expression in human pancreas.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UBE2Q2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart