UBE2Q2 MaxPab mouse polyclonal antibody (B01) View larger

UBE2Q2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2Q2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about UBE2Q2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00092912-B01
Product name: UBE2Q2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human UBE2Q2 protein.
Gene id: 92912
Gene name: UBE2Q2
Gene alias: DKFZp762C143
Gene description: ubiquitin-conjugating enzyme E2Q family member 2
Genbank accession: NM_173469.1
Immunogen: UBE2Q2 (NP_775740.1, 1 a.a. ~ 375 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG
Protein accession: NP_775740.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00092912-B01-13-15-1.jpg
Application image note: Western Blot analysis of UBE2Q2 expression in transfected 293T cell line (H00092912-T01) by UBE2Q2 MaxPab polyclonal antibody.

Lane 1: UBE2Q2 transfected lysate(41.25 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice
Publications: An intronic microRNA silences genes that are functionally antagonistic to its host gene.Barik S.
Nucleic Acids Res. 2008 Sep;36(16):5232-41. Epub 2008 Aug 6.

Reviews

Buy UBE2Q2 MaxPab mouse polyclonal antibody (B01) now

Add to cart