Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00092822-B01 |
Product name: | ZFP276 MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human ZFP276 protein. |
Gene id: | 92822 |
Gene name: | ZNF276 |
Gene alias: | FLJ38685|FLJ77809|MGC111410|MGC126480|MGC45417|ZFP276|ZNF477 |
Gene description: | zinc finger protein 276 |
Genbank accession: | BC111408.1 |
Immunogen: | ZFP276 (AAI11409.1, 1 a.a. ~ 373 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDTSSSCKAFLLDSALAVKWPRDKETAPRLPQHRGWNPGDAPQTSQGRGTGTPVGAETKTLPSTDVAQPPSDSDAVGPRSGFPPQPSLPLCRAPGQLGEKQLPSSTSDDRVKDEFSDLSEGDVLSEDENDKKQNAQSSDESFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELPTIYKCPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPHPGCNKVFMIDRYLQRHVKLIHTEVRNYICDECGQTFKQRKHLLVHQMRHSGAKPLQCEVCGFQCRQRASLKYHMTKHKAETELDFACDQCGRRFEKAHNLNVHMSMVHPLTQTQDKALPLEAEPPPGPPSPSVTTEGQAVKPEPT |
Protein accession: | AAI11409.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of ZNF276 expression in transfected 293T cell line (H00092822-T01) by ZNF276 MaxPab polyclonal antibody. Lane 1: ZFP276 transfected lysate(41.03 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |