| Brand: | Abnova |
| Reference: | H00092736-M10 |
| Product name: | OTOP2 monoclonal antibody (M10), clone 4F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant OTOP2. |
| Clone: | 4F6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 92736 |
| Gene name: | OTOP2 |
| Gene alias: | - |
| Gene description: | otopetrin 2 |
| Genbank accession: | NM_178160 |
| Immunogen: | OTOP2 (NP_835454, 423 a.a. ~ 493 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ESLHRGPPGAEPHSTHPKEPCQDLTFTNLDALHTLSACPPNPGLVSPSPSDQREAVAIVSTPRSQWRRQCL |
| Protein accession: | NP_835454 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | OTOP2 monoclonal antibody (M10), clone 4F6. Western Blot analysis of OTOP2 expression in MCF-7(Cat # L046V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |