Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MOBKL1A monoclonal antibody (M07), clone 2F8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA |
More info about MOBKL1A monoclonal antibody (M07), clone 2F8
| Brand: | Abnova |
| Reference: | H00092597-M07 |
| Product name: | MOBKL1A monoclonal antibody (M07), clone 2F8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MOBKL1A. |
| Clone: | 2F8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 92597 |
| Gene name: | MOBKL1A |
| Gene alias: | MATS2|MGC33910|MOB4A|Mob1B |
| Gene description: | MOB1, Mps One Binder kinase activator-like 1A (yeast) |
| Genbank accession: | NM_173468 |
| Immunogen: | MOBKL1A (NP_775739.1, 120 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR |
| Protein accession: | NP_775739.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to MOBKL1A on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA |
| Shipping condition: | Dry Ice |