No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Brand: | Abnova |
| Reference: | H00092335-M02 |
| Product name: | LYK5 monoclonal antibody (M02), clone 4E4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LYK5. |
| Clone: | 4E4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 92335 |
| Gene name: | STRADA |
| Gene alias: | FLJ90524|LYK5|NY-BR-96|PMSE|STRAD|Stlk |
| Gene description: | STE20-related kinase adaptor alpha |
| Genbank accession: | NM_153335 |
| Immunogen: | LYK5 (NP_699166.2, 251 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARYPCWPGPGLRESRGCS |
| Protein accession: | NP_699166.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | LYK5 monoclonal antibody (M02), clone 4E4. Western Blot analysis of LYK5 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |