No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti |
| Brand: | Abnova |
| Reference: | H00092335-D01P |
| Product name: | STRADA purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human STRADA protein. |
| Gene id: | 92335 |
| Gene name: | STRADA |
| Gene alias: | FLJ90524|LYK5|NY-BR-96|PMSE|STRAD|Stlk |
| Gene description: | STE20-related kinase adaptor alpha |
| Genbank accession: | NM_153335 |
| Immunogen: | STRADA (NP_699166.2, 1 a.a. ~ 348 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARYPCWPGPGLRESRGCSGG |
| Protein accession: | NP_699166.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | STRADA MaxPab rabbit polyclonal antibody. Western Blot analysis of STRADA expression in human kidney. |
| Applications: | WB-Ti |
| Shipping condition: | Dry Ice |