No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00092304-M03 |
Product name: | SCGB3A1 monoclonal antibody (M03), clone 3G5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SCGB3A1. |
Clone: | 3G5 |
Isotype: | IgG2a Kappa |
Gene id: | 92304 |
Gene name: | SCGB3A1 |
Gene alias: | HIN-1|HIN1|LU105|MGC87867|PnSP-2|UGRP2 |
Gene description: | secretoglobin, family 3A, member 1 |
Genbank accession: | BC029176 |
Immunogen: | SCGB3A1 (AAH29176, 1 a.a. ~ 104 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG |
Protein accession: | AAH29176 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged SCGB3A1 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |