| Brand: | Abnova |
| Reference: | H00091851-M02A |
| Product name: | CHRDL1 monoclonal antibody (M02A), clone 1D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CHRDL1. |
| Clone: | 1D10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 91851 |
| Gene name: | CHRDL1 |
| Gene alias: | CHL|NRLN1|VOPT|dA141H5.1 |
| Gene description: | chordin-like 1 |
| Genbank accession: | NM_145234 |
| Immunogen: | CHRDL1 (NP_660277, 347 a.a. ~ 456 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPVYESVFMEDGETTRKIALETERPPQVEVHVWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFTEGEAQISQMCSSRVCRTELEDLVKVLYLERSEKGHC |
| Protein accession: | NP_660277 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |