| Brand: | Abnova |
| Reference: | H00091754-M01 |
| Product name: | NEK9 monoclonal antibody (M01), clone 1F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NEK9. |
| Clone: | 1F6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 91754 |
| Gene name: | NEK9 |
| Gene alias: | DKFZp434D0935|MGC138306|MGC16714|NERCC|NERCC1|Nek8 |
| Gene description: | NIMA (never in mitosis gene a)- related kinase 9 |
| Genbank accession: | BC009336 |
| Immunogen: | NEK9 (AAH09336, 226 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL |
| Protein accession: | AAH09336 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to NEK9 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | First insight into the kinome of human regulatory T cells.Konig S, Probst-Kepper M, Reinl T, Jeron A, Huehn J, Schraven B, Jansch L. PLoS One. 2012;7(7):e40896. Epub 2012 Jul 16. |