Cart 22 Product Products 7 720,40 € (empty)
No products
To be determined Shipping
7 720,40 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 22 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 7 720,40 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 7 720,40 €
Data sheet of DKFZp434B1231 monoclonal antibody (M01), clone 5B12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about DKFZp434B1231 monoclonal antibody (M01), clone 5B12
| Brand: | Abnova |
| Reference: | H00091156-M01 |
| Product name: | DKFZp434B1231 monoclonal antibody (M01), clone 5B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DKFZp434B1231. |
| Clone: | 5B12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 91156 |
| Gene name: | IGFN1 |
| Gene alias: | DKFZp434B1231|EEF1A2BP1 |
| Gene description: | immunoglobulin-like and fibronectin type III domain containing 1 |
| Genbank accession: | NM_178275 |
| Immunogen: | DKFZp434B1231 (NP_840059, 720 a.a. ~ 818 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP |
| Protein accession: | NP_840059 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to DKFZp434B1231 on HeLa cell. [antibody concentration 15 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |