No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00091156-M01 |
Product name: | DKFZp434B1231 monoclonal antibody (M01), clone 5B12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DKFZp434B1231. |
Clone: | 5B12 |
Isotype: | IgG2a Kappa |
Gene id: | 91156 |
Gene name: | IGFN1 |
Gene alias: | DKFZp434B1231|EEF1A2BP1 |
Gene description: | immunoglobulin-like and fibronectin type III domain containing 1 |
Genbank accession: | NM_178275 |
Immunogen: | DKFZp434B1231 (NP_840059, 720 a.a. ~ 818 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP |
Protein accession: | NP_840059 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to DKFZp434B1231 on HeLa cell. [antibody concentration 15 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |