No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00091156-A01 |
| Product name: | DKFZp434B1231 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant DKFZp434B1231. |
| Gene id: | 91156 |
| Gene name: | IGFN1 |
| Gene alias: | DKFZp434B1231|EEF1A2BP1 |
| Gene description: | immunoglobulin-like and fibronectin type III domain containing 1 |
| Genbank accession: | NM_178275 |
| Immunogen: | DKFZp434B1231 (NP_840059, 720 a.a. ~ 818 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GILPGHEYHFRVVAKNELGASKPSDTSQPWCIPRQRDRFTVKAPCYREPDLSQKPRFLVGLRSHLLPQGCECCMSCAVQGSPRPHVTWFKNDRSLEGNP |
| Protein accession: | NP_840059 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | DKFZp434B1231 polyclonal antibody (A01), Lot # 051024JC01 Western Blot analysis of DKFZp434B1231 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of Molecular Tumor Markers in Renal Cell Carcinomas with TFE3 Protein Expression by RNA Sequencing.Pflueger D, Sboner A, Storz M, Roth J, Comp廨at E, Bruder E, Rubin MA, Schraml P, Moch H. Neoplasia. 2013 Nov;15(11):1231-40. |