No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | S-ELISA,ELISA | 
| Brand: | Abnova | 
| Reference: | H00090952-M03 | 
| Product name: | ESAM monoclonal antibody (M03), clone 1G8 | 
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ESAM. | 
| Clone: | 1G8 | 
| Isotype: | IgG2a Kappa | 
| Gene id: | 90952 | 
| Gene name: | ESAM | 
| Gene alias: | W117m | 
| Gene description: | endothelial cell adhesion molecule | 
| Genbank accession: | BC016868 | 
| Immunogen: | ESAM (AAH16868, 1 a.a. ~ 390 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV | 
| Protein accession: | AAH16868 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Detection limit for recombinant GST tagged ESAM is 0.3 ng/ml as a capture antibody. | 
| Applications: | S-ELISA,ELISA | 
| Shipping condition: | Dry Ice |