| Brand: | Abnova |
| Reference: | H00090865-M01 |
| Product name: | IL33 monoclonal antibody (M01), clone 2D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IL33. |
| Clone: | 2D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 90865 |
| Gene name: | IL33 |
| Gene alias: | C9orf26|DKFZp586H0523|DVS27|NF-HEV|NFEHEV|RP11-575C20.2 |
| Gene description: | interleukin 33 |
| Genbank accession: | NM_033439 |
| Immunogen: | IL33 (NP_254274.1, 171 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSE |
| Protein accession: | NP_254274.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IL33 monoclonal antibody (M01), clone 2D8. Western Blot analysis of IL33 expression in human stomach. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |