View larger

CCDC126 purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of CCDC126 purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00090693-B01P
Product name:	CCDC126 purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human CCDC126 protein.
Gene id:	90693
Gene name:	CCDC126
Gene alias:	FLJ23031\|MGC104248
Gene description:	coiled-coil domain containing 126
Genbank accession:	NM_138771
Immunogen:	CCDC126 (NP_620126.2, 1 a.a. ~ 140 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQQPRHQSSVKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSIR
Protein accession:	NP_620126.2
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of CCDC126 expression in transfected 293T cell line (H00090693-T01) by CCDC126 MaxPab polyclonal antibody. Lane 1: CCDC126 transfected lysate(15.4 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Ti,WB-Tr
Shipping condition:	Dry Ice