| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00090527-B01P |
| Product name: | NIP purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NIP protein. |
| Gene id: | 90527 |
| Gene name: | DUOXA1 |
| Gene alias: | FLJ32334|NIP|NUMBIP|mol |
| Gene description: | dual oxidase maturation factor 1 |
| Genbank accession: | BC020841 |
| Immunogen: | NIP (AAH20841, 1 a.a. ~ 298 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MATLGHTFPFYAGPKPTFPMDTTLASIIMIFLTALATFIVILPGIRGKTRLFWLLRVVTSLFIGAAILGTPVQQLNETINYNEEFTWRLGENYAEEYAKALEKGLPDPVLYLAEKFTPRSPCGLYRQYRLAGHYTSAMLWVAFLCWLLANVMLSMPVLVYGGYMLLATGIFQLLALLFFSMATSLTSPCPLHLGASVLHTHHGPAFWITLTTGLLCVLLGLAMAVAHRMQPHRLKAFFNQSVDEDPMLEWSPEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYCKEAHPKDPDCAL |
| Protein accession: | AAH20841 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of DUOXA1 expression in transfected 293T cell line (H00090527-T01) by DUOXA1 MaxPab polyclonal antibody. Lane 1: NIP transfected lysate(32.89 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | DUOX1 silencing in lung cancer promotes EMT, cancer stem cell characteristics and invasive properties.Little AC, Sham D, Hristova M, Danyal K, Heppner DE, Bauer RA, Sipsey LM, Habibovic A, van der Vliet A. Oncogenesis. 2016 Oct 3;5(10):e261. |