No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Tr |
Brand: | Abnova |
Reference: | H00090480-B01P |
Product name: | GADD45GIP1 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human GADD45GIP1 protein. |
Gene id: | 90480 |
Gene name: | GADD45GIP1 |
Gene alias: | CKBBP2|CRIF1|MGC4667|MGC4758|PLINP-1|PRG6|Plinp1 |
Gene description: | growth arrest and DNA-damage-inducible, gamma interacting protein 1 |
Genbank accession: | NM_052850 |
Immunogen: | GADD45GIP1 (NP_443082, 1 a.a. ~ 222 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAASVRQARSLLGVAATLAPGSRGYRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLGYQVDPRSARFQELLQDLEKKERKRLKEEKQKRKKEARAAALAAAVAQDPAASGAPSS |
Protein accession: | NP_443082 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of GADD45GIP1 expression in transfected 293T cell line (H00090480-T02) by GADD45GIP1 MaxPab polyclonal antibody. Lane 1: GADD45GIP1 transfected lysate(24.42 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |