| Brand: | Abnova |
| Reference: | H00090411-M12 |
| Product name: | MCFD2 monoclonal antibody (M12), clone X1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant MCFD2. |
| Clone: | X1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 90411 |
| Gene name: | MCFD2 |
| Gene alias: | DKFZp686G21263|F5F8D|LMAN1IP|SDNSF |
| Gene description: | multiple coagulation factor deficiency 2 |
| Genbank accession: | BC040357 |
| Immunogen: | MCFD2 (AAH40357, 1 a.a. ~ 146 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ |
| Protein accession: | AAH40357 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to MCFD2 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |