Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MCFD2 monoclonal antibody (M01), clone 3A5-G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about MCFD2 monoclonal antibody (M01), clone 3A5-G4
| Brand: | Abnova |
| Reference: | H00090411-M01 |
| Product name: | MCFD2 monoclonal antibody (M01), clone 3A5-G4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MCFD2. |
| Clone: | 3A5-G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 90411 |
| Gene name: | MCFD2 |
| Gene alias: | DKFZp686G21263|F5F8D|LMAN1IP|SDNSF |
| Gene description: | multiple coagulation factor deficiency 2 |
| Genbank accession: | BC040357 |
| Immunogen: | MCFD2 (AAH40357, 1 a.a. ~ 146 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ |
| Protein accession: | AAH40357 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to MCFD2 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |