MCFD2 MaxPab mouse polyclonal antibody (B01) View larger

MCFD2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MCFD2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MCFD2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00090411-B01
Product name: MCFD2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human MCFD2 protein.
Gene id: 90411
Gene name: MCFD2
Gene alias: DKFZp686G21263|F5F8D|LMAN1IP|SDNSF
Gene description: multiple coagulation factor deficiency 2
Genbank accession: BC040357
Immunogen: MCFD2 (AAH40357, 1 a.a. ~ 146 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTMRSLLRTPFLCGLLWAFCAPGARAEEPAASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ
Protein accession: AAH40357
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00090411-B01-13-15-1.jpg
Application image note: Western Blot analysis of MCFD2 expression in transfected 293T cell line (H00090411-T01) by MCFD2 MaxPab polyclonal antibody.

Lane1:MCFD2 transfected lysate(16.17 KDa).
Lane 2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MCFD2 MaxPab mouse polyclonal antibody (B01) now

Add to cart