| Brand:  | Abnova | 
| Reference:  | H00090338-M04 | 
| Product name:  | ZNF160 monoclonal antibody (M04), clone 3B8 | 
| Product description:  | Mouse monoclonal antibody raised against a full-length recombinant ZNF160. | 
| Clone:  | 3B8 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 90338 | 
| Gene name:  | ZNF160 | 
| Gene alias:  | DKFZp686B16128|F11|FLJ00032|HKr18|HZF5|KIAA1611|KR18 | 
| Gene description:  | zinc finger protein 160 | 
| Genbank accession:  | ENST00000355147 | 
| Immunogen:  | ZNF160 (ENSP00000347273, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF | 
| Protein accession:  | ENSP00000347273 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged ZNF160 is 1 ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA | 
| Shipping condition:  | Dry Ice |