Brand: | Abnova |
Reference: | H00089885-M08 |
Product name: | FATE1 monoclonal antibody (M08), clone 3B1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FATE1. |
Clone: | 3B1 |
Isotype: | IgG1 Kappa |
Gene id: | 89885 |
Gene name: | FATE1 |
Gene alias: | FATE |
Gene description: | fetal and adult testis expressed 1 |
Genbank accession: | NM_033085 |
Immunogen: | FATE1 (NP_149076, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQE |
Protein accession: | NP_149076 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to FATE1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |