Brand: | Abnova |
Reference: | H00089884-M32 |
Product name: | LHX4 monoclonal antibody (M32), clone 4F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LHX4. |
Clone: | 4F6 |
Isotype: | IgG2b Kappa |
Gene id: | 89884 |
Gene name: | LHX4 |
Gene alias: | Gsh-4|Gsh4 |
Gene description: | LIM homeobox 4 |
Genbank accession: | NM_033343 |
Immunogen: | LHX4 (NP_203129, 291 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEMDHPPF |
Protein accession: | NP_203129 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | LHX4 monoclonal antibody (M32), clone 4F6. Western Blot analysis of LHX4 expression in human pancreas. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |