No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | WB-Ce,IF,ELISA,WB-Re | 
| Brand: | Abnova | 
| Reference: | H00089884-M16 | 
| Product name: | LHX4 monoclonal antibody (M16), clone 3B4 | 
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant LHX4. | 
| Clone: | 3B4 | 
| Isotype: | IgG2a Kappa | 
| Gene id: | 89884 | 
| Gene name: | LHX4 | 
| Gene alias: | Gsh-4|Gsh4 | 
| Gene description: | LIM homeobox 4 | 
| Genbank accession: | NM_033343 | 
| Immunogen: | LHX4 (NP_203129, 291 a.a. ~ 390 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | SMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEMDHPPF | 
| Protein accession: | NP_203129 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | LHX4 monoclonal antibody (M16), clone 3B4 Western Blot analysis of LHX4 expression in THP-1 ( Cat # L007V1 ). | 
| Applications: | WB-Ce,IF,ELISA,WB-Re | 
| Shipping condition: | Dry Ice |