| Brand: | Abnova |
| Reference: | H00089884-M15 |
| Product name: | LHX4 monoclonal antibody (M15), clone 1D6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant LHX4. |
| Clone: | 1D6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 89884 |
| Gene name: | LHX4 |
| Gene alias: | Gsh-4|Gsh4 |
| Gene description: | LIM homeobox 4 |
| Genbank accession: | NM_033343 |
| Immunogen: | LHX4 (NP_203129, 291 a.a. ~ 390 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SMDGTGQSYQDLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPTSDISTGSSVGYPDFPTSPGSWLDEMDHPPF |
| Protein accession: | NP_203129 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LHX4 monoclonal antibody (M15), clone 1D6. Western Blot analysis of LHX4 expression in human spleen. |
| Applications: | WB-Ti,IHC-P,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |