LHX4 monoclonal antibody (M05), clone 4D7 View larger

LHX4 monoclonal antibody (M05), clone 4D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LHX4 monoclonal antibody (M05), clone 4D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re

More info about LHX4 monoclonal antibody (M05), clone 4D7

Brand: Abnova
Reference: H00089884-M05
Product name: LHX4 monoclonal antibody (M05), clone 4D7
Product description: Mouse monoclonal antibody raised against a partial recombinant LHX4.
Clone: 4D7
Isotype: IgG2a Kappa
Gene id: 89884
Gene name: LHX4
Gene alias: Gsh-4|Gsh4
Gene description: LIM homeobox 4
Genbank accession: NM_033343
Immunogen: LHX4 (NP_203129, 208 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRDGS
Protein accession: NP_203129
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00089884-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00089884-M05-2-B4-1.jpg
Application image note: LHX4 monoclonal antibody (M05), clone 4D7. Western Blot analysis of LHX4 expression in human skeletal muscle.
Applications: WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LHX4 monoclonal antibody (M05), clone 4D7 now

Add to cart