Cart 38 Product Products 33 029,97 € (empty)
No products
265,00 € DAP Shipping
33 294,97 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 38 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 33 029,97 €
Total shipping (tax excl.) 265,00 €
Total (tax excl.) 33 294,97 €
Data sheet of TSGA2 monoclonal antibody (M01), clone 3G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about TSGA2 monoclonal antibody (M01), clone 3G6
| Brand: | Abnova |
| Reference: | H00089765-M01 |
| Product name: | TSGA2 monoclonal antibody (M01), clone 3G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TSGA2. |
| Clone: | 3G6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 89765 |
| Gene name: | RSPH1 |
| Gene alias: | MGC126568|MGC141927|RSP44|RSPH10A|TSA2|TSGA2 |
| Gene description: | radial spoke head 1 homolog (Chlamydomonas) |
| Genbank accession: | NM_080860 |
| Immunogen: | TSGA2 (NP_543136, 200 a.a. ~ 309 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EELVTVVPKWKATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFRYDMDEGNINSEEEETRQSDLQD |
| Protein accession: | NP_543136 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged RSPH1 is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |