Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00085479-B01P |
Product name: | DNAJC5B purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human DNAJC5B protein. |
Gene id: | 85479 |
Gene name: | DNAJC5B |
Gene alias: | CSP-beta|MGC26226 |
Gene description: | DnaJ (Hsp40) homolog, subfamily C, member 5 beta |
Genbank accession: | NM_033105 |
Immunogen: | DNAJC5B (NP_149096, 1 a.a. ~ 199 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MACNIPNQRQRTLSTTGEALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISKRSIYDKYGSLGLYVAEQFGDENVNTYFMLSSWWAKALFVIVGLLTGCYFCCCLCCCCNCCCGHCRPESSVPEEDFYVSPEDLEEQIKSDMEKDVDFPVFLQPTNANEKTQLIKEGSRSYCTDS |
Protein accession: | NP_149096 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of DNAJC5B expression in transfected 293T cell line by DNAJC5B MaxPab polyclonal antibody. Lane 1: DNAJC5B transfected lysate(21.89 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |