Brand: | Abnova |
Reference: | H00085474-M02 |
Product name: | LBX2 monoclonal antibody (M02), clone 3A5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LBX2. |
Clone: | 3A5 |
Isotype: | IgG2a Kappa |
Gene id: | 85474 |
Gene name: | LBX2 |
Gene alias: | LP3727 |
Gene description: | ladybird homeobox 2 |
Genbank accession: | NM_001009812 |
Immunogen: | LBX2 (NP_001009812.1, 95 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRDVEEMRADVASLRALSPEVLCSLALPEGAPDPGLCLGPAGPDSRPHLSDEEIQVDD |
Protein accession: | NP_001009812.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to LBX2 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |