| Brand: | Abnova |
| Reference: | H00085443-M01 |
| Product name: | DCLK3 monoclonal antibody (M01), clone 2B1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DCLK3. |
| Clone: | 2B1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 85443 |
| Gene name: | DCLK3 |
| Gene alias: | DCAMKL3|DCDC3C|KIAA1765 |
| Gene description: | doublecortin-like kinase 3 |
| Genbank accession: | XM_047355 |
| Immunogen: | DCLK3 (NP_208382.1, 175 a.a. ~ 284 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGF |
| Protein accession: | NP_208382.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DCLK3 monoclonal antibody (M01), clone 2B1. Western Blot analysis of DCLK3 expression in human pancreas. |
| Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |