| Brand: | Abnova |
| Reference: | H00085363-M06 |
| Product name: | TRIM5 monoclonal antibody (M06), clone 2A6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM5. |
| Clone: | 2A6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 85363 |
| Gene name: | TRIM5 |
| Gene alias: | RNF88|TRIM5alpha |
| Gene description: | tripartite motif-containing 5 |
| Genbank accession: | NM_033034 |
| Immunogen: | TRIM5 (NP_149023, 309 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHYWEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSF |
| Protein accession: | NP_149023 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |