No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human | 
| Host species | Mouse | 
| Applications | IF,S-ELISA,ELISA,WB-Re | 
| Brand: | Abnova | 
| Reference: | H00085320-M02 | 
| Product name: | ABCC11 monoclonal antibody (M02), clone 4H6 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ABCC11. | 
| Clone: | 4H6 | 
| Isotype: | IgG2a Kappa | 
| Gene id: | 85320 | 
| Gene name: | ABCC11 | 
| Gene alias: | EWWD|MRP8|WW | 
| Gene description: | ATP-binding cassette, sub-family C (CFTR/MRP), member 11 | 
| Genbank accession: | NM_032583 | 
| Immunogen: | ABCC11 (NP_115972.2, 433 a.a. ~ 532 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | FVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINL | 
| Protein accession: | NP_115972.2 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human | 
| Application image: | ![]()  | 
| Application image note: | Detection limit for recombinant GST tagged ABCC11 is 0.1 ng/ml as a capture antibody. | 
| Applications: | IF,S-ELISA,ELISA,WB-Re | 
| Shipping condition: | Dry Ice | 
| Publications: | Salinomycin overcomes ABC transporter-mediated multidrug and apoptosis resistance in human leukemia stem cell-like KG-1a cells.Fuchs D, Daniel V, Sadeghi M, Opelz G, Naujokat C. Biochem Biophys Res Commun. 2010 Mar 27. [Epub ahead of print]  |