Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ABCC11 monoclonal antibody (M02), clone 4H6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about ABCC11 monoclonal antibody (M02), clone 4H6
| Brand: | Abnova |
| Reference: | H00085320-M02 |
| Product name: | ABCC11 monoclonal antibody (M02), clone 4H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ABCC11. |
| Clone: | 4H6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 85320 |
| Gene name: | ABCC11 |
| Gene alias: | EWWD|MRP8|WW |
| Gene description: | ATP-binding cassette, sub-family C (CFTR/MRP), member 11 |
| Genbank accession: | NM_032583 |
| Immunogen: | ABCC11 (NP_115972.2, 433 a.a. ~ 532 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINL |
| Protein accession: | NP_115972.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ABCC11 is 0.1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Salinomycin overcomes ABC transporter-mediated multidrug and apoptosis resistance in human leukemia stem cell-like KG-1a cells.Fuchs D, Daniel V, Sadeghi M, Opelz G, Naujokat C. Biochem Biophys Res Commun. 2010 Mar 27. [Epub ahead of print] |