View larger

C6orf33 (Human) Recombinant Protein (P01)

Reference:

Condition: New product

Data sheet of C6orf33 (Human) Recombinant Protein (P01)

Brand:	Abnova
Reference:	H00085315-P01
Product name:	C6orf33 (Human) Recombinant Protein (P01)
Product description:	Human C6orf33 full-length ORF ( AAH30664, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	85315
Gene name:	PAQR8
Gene alias:	C6orf33\|FLJ32521\|FLJ46206\|LMPB1\|MPRB
Gene description:	progestin and adipoQ receptor family member VIII
Genbank accession:	BC030664
Immunogen sequence/protein sequence:	MTTAILERLSTLSVSGQRLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYCYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS
Protein accession:	AAH30664
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice