| Brand: | Abnova |
| Reference: | H00085313-M01 |
| Product name: | PPIL4 monoclonal antibody (M01), clone 1C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PPIL4. |
| Clone: | 1C10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 85313 |
| Gene name: | PPIL4 |
| Gene alias: | HDCME13P |
| Gene description: | peptidylprolyl isomerase (cyclophilin)-like 4 |
| Genbank accession: | NM_139126 |
| Immunogen: | PPIL4 (NP_624311, 395 a.a. ~ 466 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLY |
| Protein accession: | NP_624311 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PPIL4 monoclonal antibody (M01), clone 1C10 Western Blot analysis of PPIL4 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |