| Brand:  | Abnova | 
| Reference:  | H00085313-M01 | 
| Product name:  | PPIL4 monoclonal antibody (M01), clone 1C10 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant PPIL4. | 
| Clone:  | 1C10 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 85313 | 
| Gene name:  | PPIL4 | 
| Gene alias:  | HDCME13P | 
| Gene description:  | peptidylprolyl isomerase (cyclophilin)-like 4 | 
| Genbank accession:  | NM_139126 | 
| Immunogen:  | PPIL4 (NP_624311, 395 a.a. ~ 466 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | EKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLY | 
| Protein accession:  | NP_624311 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (33.66 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | PPIL4 monoclonal antibody (M01), clone 1C10 Western Blot analysis of PPIL4 expression in Hela S3 NE ( Cat # L013V3 ). | 
| Applications:  | WB-Ce,IF,ELISA,WB-Re,WB-Tr,RNAi-Ab | 
| Shipping condition:  | Dry Ice |