View larger

MGC15875 (Human) Recombinant Protein (P02)

Reference:

Condition: New product

Data sheet of MGC15875 (Human) Recombinant Protein (P02)

Brand:	Abnova
Reference:	H00085007-P02
Product name:	MGC15875 (Human) Recombinant Protein (P02)
Product description:	Human MGC15875 full-length ORF ( ENSP00000321290, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	85007
Gene name:	AGXT2L2
Gene alias:	MGC117348\|MGC15875\|MGC45484
Gene description:	alanine-glyoxylate aminotransferase 2-like 2
Genbank accession:	ENST00000323594
Immunogen sequence/protein sequence:	MGKSIGNGHPVACVAATQPVARAFEATGVEYFNTFGGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTDMEEKVRSCETLRLQP
Protein accession:	ENSP00000321290
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice