No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,ELISA |
Brand: | Abnova |
Reference: | H00084961-M03 |
Product name: | FBXL20 monoclonal antibody (M03), clone 2G1 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant FBXL20. |
Clone: | 2G1 |
Isotype: | IgG1 Kappa |
Gene id: | 84961 |
Gene name: | FBXL20 |
Gene alias: | Fbl2|Fbl20|MGC15482|SCR|SCRAPPER |
Gene description: | F-box and leucine-rich repeat protein 20 |
Genbank accession: | BC007557 |
Immunogen: | FBXL20 (AAH07557, 1 a.a. ~ 436 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MRRDVNGVTKSRFEMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSVGGSRQRFCRCCIIL |
Protein accession: | AAH07557 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | FBXL20 monoclonal antibody (M03), clone 2G1. Western Blot analysis of FBXL20 expression in human colon. |
Applications: | WB-Ti,ELISA |
Shipping condition: | Dry Ice |