Cart 2 Product Products 231,20 € (empty)
No products
To be determined Shipping
231,20 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 231,20 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 231,20 €
Data sheet of FBXL20 monoclonal antibody (M03), clone 2G1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,ELISA |
More info about FBXL20 monoclonal antibody (M03), clone 2G1
| Brand: | Abnova |
| Reference: | H00084961-M03 |
| Product name: | FBXL20 monoclonal antibody (M03), clone 2G1 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant FBXL20. |
| Clone: | 2G1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 84961 |
| Gene name: | FBXL20 |
| Gene alias: | Fbl2|Fbl20|MGC15482|SCR|SCRAPPER |
| Gene description: | F-box and leucine-rich repeat protein 20 |
| Genbank accession: | BC007557 |
| Immunogen: | FBXL20 (AAH07557, 1 a.a. ~ 436 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRRDVNGVTKSRFEMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSVGGSRQRFCRCCIIL |
| Protein accession: | AAH07557 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | FBXL20 monoclonal antibody (M03), clone 2G1. Western Blot analysis of FBXL20 expression in human colon. |
| Applications: | WB-Ti,ELISA |
| Shipping condition: | Dry Ice |