No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ce,WB-Ti,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00084957-D01P |
Product name: | RELT purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human RELT protein. |
Gene id: | 84957 |
Gene name: | RELT |
Gene alias: | FLJ14993|TNFRSF19L |
Gene description: | RELT tumor necrosis factor receptor |
Genbank accession: | NM_032871.3 |
Immunogen: | RELT (NP_116260.2, 1 a.a. ~ 430 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MKPSLLCRPLSCFLMLLPWPLATLTSTTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAAQYAVIAIVPVFCLMGLLGILVCNLLKRKGYHCTAHKEVGPGPGGGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHICPHRHHLHTVQGLASLSGPCCSRCSQKKWPEVLLSPEAVAATTPVPSLLPNPTRVPKAGAKAGRQGEITILSVGRFRVARIPEQRTSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYVVRLSESNLVI |
Protein accession: | NP_116260.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | RELT MaxPab rabbit polyclonal antibody. Western Blot analysis of RELT expression in HeLa. |
Applications: | WB-Ce,WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |