Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CIRH1A polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about CIRH1A polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00084916-A01 |
| Product name: | CIRH1A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CIRH1A. |
| Gene id: | 84916 |
| Gene name: | CIRH1A |
| Gene alias: | CIRHIN|FLJ14728|FLJ17146|KIAA1988|NAIC|TEX292 |
| Gene description: | cirrhosis, autosomal recessive 1A (cirhin) |
| Genbank accession: | NM_032830 |
| Immunogen: | CIRH1A (NP_116219, 587 a.a. ~ 686 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SFHPKRPMHILLHDAYMFCIIDKSLPLPNDKTLLYNPFPPTNESDVIRRRTAHAFKISKIYKPLLFMDLLDERTLVAVERPLDDIIAQLPPPIKKKKFGT |
| Protein accession: | NP_116219 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CIRH1A polyclonal antibody (A01), Lot # 060112JC01. Western Blot analysis of CIRH1A expression in Daoy. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | NOL11, Implicated in the Pathogenesis of North American Indian Childhood Cirrhosis, Is Required for Pre-rRNA Transcription and Processing.Freed EF, Prieto JL, McCann KL, McStay B, Baserga SJ. PLoS Genet. 2012 Aug;8(8):e1002892. Epub 2012 Aug 16. |