Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NFATC2IP monoclonal antibody (M02), clone 3E9-B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about NFATC2IP monoclonal antibody (M02), clone 3E9-B7
| Brand: | Abnova |
| Reference: | H00084901-M02 |
| Product name: | NFATC2IP monoclonal antibody (M02), clone 3E9-B7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant NFATC2IP. |
| Clone: | 3E9-B7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 84901 |
| Gene name: | NFATC2IP |
| Gene alias: | FLJ14639|MGC126790|MGC138387 |
| Gene description: | nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein |
| Genbank accession: | BC018311 |
| Immunogen: | NFATC2IP (AAH18311, 1 a.a. ~ 138 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG |
| Protein accession: | AAH18311 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.92 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of NFATC2IP transfected lysate using anti-NFATC2IP monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NFATC2IP MaxPab rabbit polyclonal antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |